PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim03g034130.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 225aa    MW: 26803.2 Da    PI: 6.0056
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim03g034130.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.46.9e-2061116257
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                         rkR  +++eq++ Le+ F  ++++ +e++++LA+++gL+  qV vWFqNrRa++k+
  Sopim03g034130.0.1  61 RKRKLLSEEQVNLLERSFGDQHKLETERKAKLASEVGLDPHQVAVWFQNRRARWKN 116
                         89****************************************************95 PP

2HD-ZIP_I/II107.51e-3462152292
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         k++ ls+eqv+lLE+sF  ++kLe+erK++la+e+gl+p+qvavWFqnrRAR+k+++lE++y++Lk++++    e++rLe+ev +++e+l 
  Sopim03g034130.0.1  62 KRKLLSEEQVNLLERSFGDQHKLETERKAKLASEVGLDPHQVAVWFQNRRARWKNRKLEEEYSKLKTQHEDTIIEKCRLETEVLKMKEQLC 152
                         66778**********************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.5E-1753122IPR009057Homeodomain-like
PROSITE profilePS5007117.16757117IPR001356Homeobox domain
SMARTSM003892.3E-1859121IPR001356Homeobox domain
PfamPF000465.5E-1761116IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.8E-2061124IPR009057Homeodomain-like
CDDcd000866.79E-1561118No hitNo description
PRINTSPR000312.2E-58897IPR000047Helix-turn-helix motif
PROSITE patternPS00027092115IPR017970Homeobox, conserved site
PRINTSPR000312.2E-597113IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MEKGLNMKGN KVDDQMELIS HFYPQIYSQL AQQQEETVKP RRRRRKNKDE GRDNTSEVLM  60
RKRKLLSEEQ VNLLERSFGD QHKLETERKA KLASEVGLDP HQVAVWFQNR RARWKNRKLE  120
EEYSKLKTQH EDTIIEKCRL ETEVLKMKEQ LCEAKKEIER LLLEHKSDIS SNNSPTSSIF  180
SMEQSHFNLG EFGMEEQLMD DNMFFVADYQ SNYVTLWDNE LEWI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14363RRKNKDEGRDNTSEVLMRKRK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755150.0HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004234616.11e-165PREDICTED: homeobox-leucine zipper protein ATHB-40-like
SwissprotQ9ZU703e-59ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21
TrEMBLK4BFT51e-165K4BFT5_SOLLC; Uncharacterized protein
STRINGSolyc03g034130.2.11e-165(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12892480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.11e-54homeobox protein 40